Retatrutide
The Triple Hormone Receptor Agonist (GLP-1/GIP/Glucagon)
Retatrutide (LY3437943) is an investigational triple receptor agonist targeting GLP-1, GIP, and glucagon receptors simultaneously. Developed by Eli Lilly, it represents the next fr...
Formula
C221H352N56O67
Molecular Weight
4731.5 g/mol
Sequence
YGEGTFTSDVSSYLEGQAAKEFIAWLVKGR...
What is this compound?
Retatrutide (LY3437943) is an investigational triple receptor agonist targeting GLP-1, GIP, and glucagon receptors simultaneously. Developed by Eli Lilly, it represents the next frontier beyond dual agonists by adding glucagon receptor activity, which drives hepatic fat oxidation and energy expenditure. Phase 2 results have shown weight reductions exceeding even tirzepatide.
Triple receptor agonism — GLP-1, GIP, and glucagon
Highest weight loss percentage reported in Phase 2 obesity trials
Glucagon component drives hepatic fat oxidation and energy expenditure
Enhanced lipid profile and liver fat reduction
Potential for lean mass preservation via combined metabolic signaling
Once-weekly dosing
How it works
Retatrutide is a 39-amino-acid peptide engineered from a GIP backbone with balanced agonist activity at three receptors. GLP-1 receptor activation suppresses appetite and improves glycemic control; GIP receptor activation enhances insulin sensitivity and fat metabolism; glucagon ...
Areas of investigation
Discovery to present
1970s
Discovery
Retatrutide was first identified and characterized in research contexts.
2000s
Research
Preclinical studies expanded across multiple tissue types and disease models.
2010s
Clinical Progress
Early-stage research progressed toward translational and clinical investigation.
2024+
Current Interest
Active research continues with growing scientific interest and expanding publication volume.
Knowledge connections
Explore how Retatrutide connects to mechanisms, research goals, related compounds, and scientific references.
Research calculations
Plan research protocols with precise reconstitution, dosing, and unit conversion tools.
Reconstitution Calculator
Bacteriostatic water ratios
Dose Calculator
Precise microgram dosing
Unit Converter
Syringe unit conversions
Compare with similar compounds
Primary literature
Reference compilation in progress. See research highlights below.
TRIUMPH Phase 2 trial reports up to 24.2% mean weight loss at 12 mg weekly over 48 weeks
TRIUMPH Phase 2 trial reports up to 24.2% mean weight loss at 12 mg weekly over 48 weeks
Liver fat reduction studies show substantial decreases in hepatic triglyceride content
Liver fat reduction studies show substantial decreases in hepatic triglyceride content
Preclinical glucagon receptor studies demonstrate increased energy expenditure without hyperglycemia
Preclinical glucagon receptor studies demonstrate increased energy expenditure without hyperglycemia
Retatrutide — Frequently asked
Retatrutide (LY3437943) is an investigational triple receptor agonist targeting GLP-1, GIP, and glucagon receptors simultaneously. Developed by Eli Lilly, it represents the next frontier beyond dual a... Retatrutide belongs to the Weight Loss research category and is studied for its the triple hormone receptor agonist (glp-1/gip/glucagon).
Retatrutide is a 39-amino-acid peptide engineered from a GIP backbone with balanced agonist activity at three receptors. GLP-1 receptor activation suppresses appetite and improves glycemic control; GIP receptor activation enhances insulin sensitivity and fat metabolism; glucagon receptor activation increases hepatic energy expenditure, lipolysis, and fatty acid oxidation. The glucagon component is designed to drive additional fat loss without hyperglycemia because GLP-1 and GIP maintain glucose-dependent insulin secretion.
Triple receptor agonism — GLP-1, GIP, and glucagon. Highest weight loss percentage reported in Phase 2 obesity trials. Glucagon component drives hepatic fat oxidation and energy expenditure. Enhanced lipid profile and liver fat reduction. Potential for lean mass preservation via combined metabolic signaling. Once-weekly dosing.
Retatrutide has the molecular formula C221H352N56O67 and a molecular weight of 4731.5 g/mol. Its amino acid sequence is YGEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (modified, triple agonist). This structural information is important for researchers studying receptor binding and pharmacokinetics.
TRIUMPH Phase 2 trial reports up to 24.2% mean weight loss at 12 mg weekly over 48 weeks Liver fat reduction studies show substantial decreases in hepatic triglyceride content Preclinical glucagon receptor studies demonstrate increased energy expenditure without hyperglycemia These findings are based on preclinical and clinical research. Retatrutide is a research compound and these studies do not constitute medical advice.
No. Retatrutide is not FDA-approved for any indication. It is a research chemical studied in preclinical and early clinical research. These compounds are not approved for human therapeutic use and should only be studied in appropriate research settings.
Retatrutide belongs to the Weight Loss category, which focuses on compounds studied for their roles in metabolic regulation, growth hormone signaling, and targeted adipose tissue reduction. You can explore more compounds in this category on the Weight Loss pillar page.
Add to your cart
Select a variant to add Retatrutide to your cart for comparison, protocol planning, and AI-assisted analysis.
Available Variants
Research Disclaimer
Retatrutide is a research compound. All information is for educational and research purposes only. Not intended for human or animal consumption. Not intended to diagnose, treat, cure, or prevent any disease.