Retatrutide
The Triple Hormone Receptor Agonist (GLP-1/GIP/Glucagon)
Molecular Data
- Formula
- C221H352N56O67
- Molecular Weight
- 4731.5 g/mol
- Sequence
- YGEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (modified, triple agoni…
01
Overview
Retatrutide (LY3437943) is an investigational triple receptor agonist targeting GLP-1, GIP, and glucagon receptors simultaneously. Developed by Eli Lilly, it represents the next frontier beyond dual agonists by adding glucagon receptor activity, which drives hepatic fat oxidation and energy expenditure. Phase 2 results have shown weight reductions exceeding even tirzepatide.
02
Mechanism of Action
Retatrutide is a 39-amino-acid peptide engineered from a GIP backbone with balanced agonist activity at three receptors. GLP-1 receptor activation suppresses appetite and improves glycemic control; GIP receptor activation enhances insulin sensitivity and fat metabolism; glucagon receptor activation increases hepatic energy expenditure, lipolysis, and fatty acid oxidation. The glucagon component is designed to drive additional fat loss without hyperglycemia because GLP-1 and GIP maintain glucose-dependent insulin secretion.
03
Research Highlights
TRIUMPH Phase 2 trial reports up to 24.2% mean weight loss at 12 mg weekly over 48 weeks
Liver fat reduction studies show substantial decreases in hepatic triglyceride content
Preclinical glucagon receptor studies demonstrate increased energy expenditure without hyperglycemia
04
Dosage
Administration & Timing
Subcutaneous (SC) injection into abdominal or gluteal subcutaneous tissue, once weekly. Investigational; research administers independent of meals.
Dosage Guidelines
Cycle Length
48 weeks in published Phase 2 research; ongoing.
05
Reconstitution
Solvent
Bacteriostatic Water (0.9% benzyl alcohol)
Volume
2 mL added to a 20 mg vial (for research preparation)
Concentration
10 mg/mL
Storage
Refrigerate at 2–8 °C; protect from light. Discard 30 days after reconstitution.
Notes
Retatrutide is a triple agonist (GLP-1/GIP/Glucagon). Investigational — use only in compliant research settings.
Research Reference Only
Dosage and reconstitution values reflect commonly cited ranges from published research literature and are presented for educational and research reference only. This is not medical advice or a dosing recommendation. HEXAGEN does not endorse human use of any compound. Always consult a qualified healthcare professional.
Research Disclaimer
Retatrutide is for educational and research purposes only. Not intended as medical advice. Consult a qualified healthcare professional before making any health-related decisions.
Related Compounds
View All
Retatrutide Knowledge Graph
Explore how Retatrutide connects to mechanisms, research goals, related compounds, research stacks, and scientific references. Drag nodes, zoom, and filter by type.
No nodes match the active filters.
Retatrutide — Common Research Questions
What is Retatrutide?
Retatrutide (LY3437943) is an investigational triple receptor agonist targeting GLP-1, GIP, and glucagon receptors simultaneously. Developed by Eli Lilly, it represents the next frontier beyond dual a... Retatrutide belongs to the Weight Loss research category and is studied for its the triple hormone receptor agonist (glp-1/gip/glucagon).
How does Retatrutide work?
Retatrutide is a 39-amino-acid peptide engineered from a GIP backbone with balanced agonist activity at three receptors. GLP-1 receptor activation suppresses appetite and improves glycemic control; GIP receptor activation enhances insulin sensitivity and fat metabolism; glucagon receptor activation increases hepatic energy expenditure, lipolysis, and fatty acid oxidation. The glucagon component is designed to drive additional fat loss without hyperglycemia because GLP-1 and GIP maintain glucose-dependent insulin secretion.
What are the key research benefits of Retatrutide?
Triple receptor agonism — GLP-1, GIP, and glucagon. Highest weight loss percentage reported in Phase 2 obesity trials. Glucagon component drives hepatic fat oxidation and energy expenditure. Enhanced lipid profile and liver fat reduction. Potential for lean mass preservation via combined metabolic signaling. Once-weekly dosing.
What is the molecular structure of Retatrutide?
Retatrutide has the molecular formula C221H352N56O67 and a molecular weight of 4731.5 g/mol. Its amino acid sequence is YGEGTFTSDVSSYLEGQAAKEFIAWLVKGRG (modified, triple agonist). This structural information is important for researchers studying receptor binding and pharmacokinetics.
What does the research say about Retatrutide?
TRIUMPH Phase 2 trial reports up to 24.2% mean weight loss at 12 mg weekly over 48 weeks Liver fat reduction studies show substantial decreases in hepatic triglyceride content Preclinical glucagon receptor studies demonstrate increased energy expenditure without hyperglycemia These findings are based on preclinical and clinical research. Retatrutide is a research compound and these studies do not constitute medical advice.
Is Retatrutide FDA approved?
No. Retatrutide is not FDA-approved for any indication. It is a research chemical studied in preclinical and early clinical research. These compounds are not approved for human therapeutic use and should only be studied in appropriate research settings.
What category does Retatrutide belong to?
Retatrutide belongs to the Weight Loss category, which focuses on compounds studied for their roles in metabolic regulation, growth hormone signaling, and targeted adipose tissue reduction. You can explore more compounds in this category on the Weight Loss pillar page.
Related Articles
Tesamorelin: Clinical Data for Visceral Fat Reduction
Phase III trial data showing 15-18% visceral fat reduction and the FDA approval rationale for Egrifta®.
AOD-9604: Lipolysis Without Growth Effects
How AOD-9604's C-terminus fragment of HGH stimulates lipolysis without the growth-promoting effects of full-length HGH.
CJC-1295 + Ipamorelin: Synergistic GH Secretagogue Research
Examining the complementary mechanisms of CJC-1295 (GHRH analogue) and Ipamorelin (ghrelin mimetic) in research settings.
Scientific References
TRIUMPH Phase 2 trial reports up to 24.2% mean weight loss at 12 mg weekly over 48 weeks
Liver fat reduction studies show substantial decreases in hepatic triglyceride content
Preclinical glucagon receptor studies demonstrate increased energy expenditure without hyperglycemia