Cagrilintide
Long-Acting Amylin Analogue for Appetite Regulation
Molecular Data
- Formula
- C174H294N44O52S2
- Molecular Weight
- 3752.7 g/mol
- Sequence
- KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY (modified, long-a…
01
Overview
Cagrilintide is a long-acting synthetic analogue of human amylin, a peptide co-secreted with insulin from pancreatic beta cells that induces satiety and suppresses glucagon. Developed by Novo Nordisk, it is being investigated both as a monotherapy and in combination with semaglutide (CagriSema) for obesity and weight management. Its mechanism complements GLP-1 therapies by targeting a distinct satiety pathway.
02
Mechanism of Action
Cagrilintide binds amylin (calcitonin receptor complex) receptors in the area postrema of the brainstem, activating satiety circuits that reduce food intake. It also suppresses postprandial glucagon secretion and slows gastric emptying, reducing the rate of nutrient absorption. Structural modifications including disulfide bonding and fatty acid conjugation extend its half-life to approximately 164 hours, enabling once-weekly dosing.
03
Research Highlights
Combination trials of CagriSema (semaglutide + cagrilintide) show greater weight loss than either agent alone
Monotherapy Phase 2 studies demonstrate dose-dependent weight reduction over 26 weeks
Primate amylin studies confirm potent anorectic effects with sustained duration of action
04
Dosage
Administration & Timing
Subcutaneous (SC) injection into abdominal or gluteal subcutaneous tissue, once weekly. Investigational amylin analog; research administers independent of meals.
Dosage Guidelines
Cycle Length
20–68 weeks in published Phase 2 research; ongoing.
05
Reconstitution
Solvent
Bacteriostatic Water (0.9% benzyl alcohol)
Volume
Per research formulation
Concentration
Per protocol
Storage
Refrigerate at 2–8 °C; protect from light. Discard 30 days after reconstitution.
Notes
Cagrilintide is a long-acting amylin analog. Investigational — published research is limited to clinical trial settings.
Research Reference Only
Dosage and reconstitution values reflect commonly cited ranges from published research literature and are presented for educational and research reference only. This is not medical advice or a dosing recommendation. HEXAGEN does not endorse human use of any compound. Always consult a qualified healthcare professional.
Research Disclaimer
Cagrilintide is for educational and research purposes only. Not intended as medical advice. Consult a qualified healthcare professional before making any health-related decisions.
Related Compounds
View All
Cagrilintide Knowledge Graph
Explore how Cagrilintide connects to mechanisms, research goals, related compounds, research stacks, and scientific references. Drag nodes, zoom, and filter by type.
No nodes match the active filters.
Cagrilintide — Common Research Questions
What is Cagrilintide?
Cagrilintide is a long-acting synthetic analogue of human amylin, a peptide co-secreted with insulin from pancreatic beta cells that induces satiety and suppresses glucagon. Developed by Novo Nordisk,... Cagrilintide belongs to the Weight Loss research category and is studied for its long-acting amylin analogue for appetite regulation.
How does Cagrilintide work?
Cagrilintide binds amylin (calcitonin receptor complex) receptors in the area postrema of the brainstem, activating satiety circuits that reduce food intake. It also suppresses postprandial glucagon secretion and slows gastric emptying, reducing the rate of nutrient absorption. Structural modifications including disulfide bonding and fatty acid conjugation extend its half-life to approximately 164 hours, enabling once-weekly dosing.
What are the key research benefits of Cagrilintide?
Amylin receptor activation for meal-ending satiety signaling. Complementary to GLP-1 pathways — distinct appetite mechanism. Sustained appetite suppression and reduced caloric intake. Glucagon suppression for improved glycemic control. Gastric emptying delay synergistic with incretin therapies. Combination with semaglutide (CagriSema) shows enhanced weight loss.
What is the molecular structure of Cagrilintide?
Cagrilintide has the molecular formula C174H294N44O52S2 and a molecular weight of 3752.7 g/mol. Its amino acid sequence is KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY (modified, long-acting). This structural information is important for researchers studying receptor binding and pharmacokinetics.
What does the research say about Cagrilintide?
Combination trials of CagriSema (semaglutide + cagrilintide) show greater weight loss than either agent alone Monotherapy Phase 2 studies demonstrate dose-dependent weight reduction over 26 weeks Primate amylin studies confirm potent anorectic effects with sustained duration of action These findings are based on preclinical and clinical research. Cagrilintide is a research compound and these studies do not constitute medical advice.
Is Cagrilintide FDA approved?
No. Cagrilintide is not FDA-approved for any indication. It is a research chemical studied in preclinical and early clinical research. These compounds are not approved for human therapeutic use and should only be studied in appropriate research settings.
What category does Cagrilintide belong to?
Cagrilintide belongs to the Weight Loss category, which focuses on compounds studied for their roles in metabolic regulation, growth hormone signaling, and targeted adipose tissue reduction. You can explore more compounds in this category on the Weight Loss pillar page.
Related Articles
Tesamorelin: Clinical Data for Visceral Fat Reduction
Phase III trial data showing 15-18% visceral fat reduction and the FDA approval rationale for Egrifta®.
AOD-9604: Lipolysis Without Growth Effects
How AOD-9604's C-terminus fragment of HGH stimulates lipolysis without the growth-promoting effects of full-length HGH.
CJC-1295 + Ipamorelin: Synergistic GH Secretagogue Research
Examining the complementary mechanisms of CJC-1295 (GHRH analogue) and Ipamorelin (ghrelin mimetic) in research settings.
Scientific References
Combination trials of CagriSema (semaglutide + cagrilintide) show greater weight loss than either agent alone
Monotherapy Phase 2 studies demonstrate dose-dependent weight reduction over 26 weeks
Primate amylin studies confirm potent anorectic effects with sustained duration of action