Tirzepatide
The Dual GIP/GLP-1 "Twincretin" Receptor Agonist
Tirzepatide is a synthetic dual agonist of both the GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) receptors, developed by Eli Lilly. Market...
Formula
C225H348N60O68
Molecular Weight
4813.5 g/mol
Sequence
YPGTFTSDVSSYLEGQAAKEFIAWLVKGRG...
What is this compound?
Tirzepatide is a synthetic dual agonist of both the GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) receptors, developed by Eli Lilly. Marketed as Mounjaro for type 2 diabetes and Zepbound for chronic weight management, it is the first-in-class "twincretin" and has produced the largest weight reductions seen in any incretin-based pharmacotherapy to date.
Highest reported weight loss in incretin pharmacotherapy class
Dual receptor activation amplifies metabolic benefit beyond GLP-1 alone
Superior HbA1c reduction versus semaglutide in head-to-head trials
GIP component enhances fat oxidation and insulin sensitivity
Once-weekly dosing with durable response
Significant cardiometabolic risk marker improvement
How it works
Tirzepatide features a 39-amino-acid peptide backbone based on native GIP with synthetic modifications that confer balanced GIP and GLP-1 receptor agonism. GIP receptor activation enhances insulin sensitivity and fat tissue metabolism, while GLP-1 receptor activation suppresses g...
Areas of investigation
Discovery to present
1970s
Discovery
Tirzepatide was first identified and characterized in research contexts.
2000s
Research
Preclinical studies expanded across multiple tissue types and disease models.
2010s
Clinical Progress
Early-stage research progressed toward translational and clinical investigation.
2024+
Current Interest
Active research continues with growing scientific interest and expanding publication volume.
Knowledge connections
Explore how Tirzepatide connects to mechanisms, research goals, related compounds, and scientific references.
Research calculations
Plan research protocols with precise reconstitution, dosing, and unit conversion tools.
Reconstitution Calculator
Bacteriostatic water ratios
Dose Calculator
Precise microgram dosing
Unit Converter
Syringe unit conversions
Compare with similar compounds
Primary literature
Reference compilation in progress. See research highlights below.
SURMOUNT-1 trial demonstrates 22.5% mean body weight reduction at 15 mg weekly over 72 weeks
SURMOUNT-1 trial demonstrates 22.5% mean body weight reduction at 15 mg weekly over 72 weeks
SURPASS head-to-head trials show superior HbA1c and weight reduction versus semaglutide 1 mg
SURPASS head-to-head trials show superior HbA1c and weight reduction versus semaglutide 1 mg
Imaging substudies show substantial reduction in visceral adipose tissue and liver fat content
Imaging substudies show substantial reduction in visceral adipose tissue and liver fat content
Tirzepatide — Frequently asked
Tirzepatide is a synthetic dual agonist of both the GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) receptors, developed by Eli Lilly. Marketed as Mounjaro for t... Tirzepatide belongs to the Weight Loss research category and is studied for its the dual gip/glp-1 "twincretin" receptor agonist.
Tirzepatide features a 39-amino-acid peptide backbone based on native GIP with synthetic modifications that confer balanced GIP and GLP-1 receptor agonism. GIP receptor activation enhances insulin sensitivity and fat tissue metabolism, while GLP-1 receptor activation suppresses glucagon, slows gastric emptying, and reduces appetite. The dual mechanism produces additive and sometimes synergistic metabolic effects. A C20 fatty di-acid chain enables albumin binding, extending half-life to approximately 160 hours.
Highest reported weight loss in incretin pharmacotherapy class. Dual receptor activation amplifies metabolic benefit beyond GLP-1 alone. Superior HbA1c reduction versus semaglutide in head-to-head trials. GIP component enhances fat oxidation and insulin sensitivity. Once-weekly dosing with durable response. Significant cardiometabolic risk marker improvement.
Tirzepatide has the molecular formula C225H348N60O68 and a molecular weight of 4813.5 g/mol. Its amino acid sequence is YPGTFTSDVSSYLEGQAAKEFIAWLVKGRG (modified, dual GIP/GLP-1). This structural information is important for researchers studying receptor binding and pharmacokinetics.
SURMOUNT-1 trial demonstrates 22.5% mean body weight reduction at 15 mg weekly over 72 weeks SURPASS head-to-head trials show superior HbA1c and weight reduction versus semaglutide 1 mg Imaging substudies show substantial reduction in visceral adipose tissue and liver fat content These findings are based on preclinical and clinical research. Tirzepatide is a research compound and these studies do not constitute medical advice.
Yes. Tirzepatide is FDA-approved under the brand names Mounjaro® (for type 2 diabetes) and Zepbound® (for chronic weight management).
Tirzepatide belongs to the Weight Loss category, which focuses on compounds studied for their roles in metabolic regulation, growth hormone signaling, and targeted adipose tissue reduction. You can explore more compounds in this category on the Weight Loss pillar page.
Add to your cart
Select a variant to add Tirzepatide to your cart for comparison, protocol planning, and AI-assisted analysis.
Available Variants
Research Disclaimer
Tirzepatide is a research compound. All information is for educational and research purposes only. Not intended for human or animal consumption. Not intended to diagnose, treat, cure, or prevent any disease.