HEXAGEN — Research · Innovation · Life
Tirzepatide
Weight Loss

Tirzepatide

The Dual GIP/GLP-1 "Twincretin" Receptor Agonist

Molecular Data

Formula
C225H348N60O68
Molecular Weight
4813.5 g/mol
Sequence
YPGTFTSDVSSYLEGQAAKEFIAWLVKGRG (modified, dual GIP/GLP-…

01

Overview

Tirzepatide is a synthetic dual agonist of both the GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) receptors, developed by Eli Lilly. Marketed as Mounjaro for type 2 diabetes and Zepbound for chronic weight management, it is the first-in-class "twincretin" and has produced the largest weight reductions seen in any incretin-based pharmacotherapy to date.

02

Mechanism of Action

Tirzepatide features a 39-amino-acid peptide backbone based on native GIP with synthetic modifications that confer balanced GIP and GLP-1 receptor agonism. GIP receptor activation enhances insulin sensitivity and fat tissue metabolism, while GLP-1 receptor activation suppresses glucagon, slows gastric emptying, and reduces appetite. The dual mechanism produces additive and sometimes synergistic metabolic effects. A C20 fatty di-acid chain enables albumin binding, extending half-life to approximately 160 hours.

03

Research Highlights

1

SURMOUNT-1 trial demonstrates 22.5% mean body weight reduction at 15 mg weekly over 72 weeks

2

SURPASS head-to-head trials show superior HbA1c and weight reduction versus semaglutide 1 mg

3

Imaging substudies show substantial reduction in visceral adipose tissue and liver fat content

04

Dosage

Administration & Timing

Subcutaneous (SC) injection into abdominal or gluteal subcutaneous tissue, once weekly. FDA-approved as Mounjaro® (T2D) and Zepbound® (weight); administered any time of day, independent of meals.

Dosage Guidelines

Weight management (Zepbound® escalation)2.5 mg → 5 mg → 7.5 mg → 10 mg → 12.5 mg → 15 mg weekly (monthly escalation)
Type 2 diabetes (Mounjaro®)2.5–15 mg weekly
Maintenance research5–15 mg weekly

Cycle Length

Indefinite in approved indications; dose escalation over 20 weeks to maintenance.

05

Reconstitution

Solvent

Supplied as pre-filled pen — no reconstitution required

Volume

Pre-filled single-dose pen (2.5, 5, 7.5, 10, 12.5, 15 mg)

Concentration

Delivered dose per pen

Storage

Refrigerate 2–8 °C; can store at room temperature (<30 °C) up to 21 days after first use.

Notes

Tirzepatide is a dual GIP/GLP-1 receptor agonist. Same-day weekly dosing; rotate sites. Nausea is most common during escalation.

Research Reference Only

Dosage and reconstitution values reflect commonly cited ranges from published research literature and are presented for educational and research reference only. This is not medical advice or a dosing recommendation. HEXAGEN does not endorse human use of any compound. Always consult a qualified healthcare professional.

Research Disclaimer

Tirzepatide is for educational and research purposes only. Not intended as medical advice. Consult a qualified healthcare professional before making any health-related decisions.

Related Compounds

View All
AOD-9604

AOD-9604

HGH Fragment — Targeted Fat Metabolism

Read Profile
CJC-1295

CJC-1295

Extended-Release GHRH Analogue

Read Profile
Ipamorelin

Ipamorelin

The Selective GH Secretagogue

Read Profile
HEXAGEN Relationship Graph™

Tirzepatide Knowledge Graph

Explore how Tirzepatide connects to mechanisms, research goals, related compounds, research stacks, and scientific references. Drag nodes, zoom, and filter by type.

Full Platform Graph
HEXAGEN Relationship Graph™
0 nodes · 0 edges

No nodes match the active filters.

Frequently Asked Questions

Tirzepatide — Common Research Questions

What is Tirzepatide?

Tirzepatide is a synthetic dual agonist of both the GIP (glucose-dependent insulinotropic polypeptide) and GLP-1 (glucagon-like peptide-1) receptors, developed by Eli Lilly. Marketed as Mounjaro for t... Tirzepatide belongs to the Weight Loss research category and is studied for its the dual gip/glp-1 "twincretin" receptor agonist.

How does Tirzepatide work?

Tirzepatide features a 39-amino-acid peptide backbone based on native GIP with synthetic modifications that confer balanced GIP and GLP-1 receptor agonism. GIP receptor activation enhances insulin sensitivity and fat tissue metabolism, while GLP-1 receptor activation suppresses glucagon, slows gastric emptying, and reduces appetite. The dual mechanism produces additive and sometimes synergistic metabolic effects. A C20 fatty di-acid chain enables albumin binding, extending half-life to approximately 160 hours.

What are the key research benefits of Tirzepatide?

Highest reported weight loss in incretin pharmacotherapy class. Dual receptor activation amplifies metabolic benefit beyond GLP-1 alone. Superior HbA1c reduction versus semaglutide in head-to-head trials. GIP component enhances fat oxidation and insulin sensitivity. Once-weekly dosing with durable response. Significant cardiometabolic risk marker improvement.

What is the molecular structure of Tirzepatide?

Tirzepatide has the molecular formula C225H348N60O68 and a molecular weight of 4813.5 g/mol. Its amino acid sequence is YPGTFTSDVSSYLEGQAAKEFIAWLVKGRG (modified, dual GIP/GLP-1). This structural information is important for researchers studying receptor binding and pharmacokinetics.

What does the research say about Tirzepatide?

SURMOUNT-1 trial demonstrates 22.5% mean body weight reduction at 15 mg weekly over 72 weeks SURPASS head-to-head trials show superior HbA1c and weight reduction versus semaglutide 1 mg Imaging substudies show substantial reduction in visceral adipose tissue and liver fat content These findings are based on preclinical and clinical research. Tirzepatide is a research compound and these studies do not constitute medical advice.

Is Tirzepatide FDA approved?

Yes. Tirzepatide is FDA-approved under the brand names Mounjaro® (for type 2 diabetes) and Zepbound® (for chronic weight management).

What category does Tirzepatide belong to?

Tirzepatide belongs to the Weight Loss category, which focuses on compounds studied for their roles in metabolic regulation, growth hormone signaling, and targeted adipose tissue reduction. You can explore more compounds in this category on the Weight Loss pillar page.

Scientific References

[1]

SURMOUNT-1 trial demonstrates 22.5% mean body weight reduction at 15 mg weekly over 72 weeks

[2]

SURPASS head-to-head trials show superior HbA1c and weight reduction versus semaglutide 1 mg

[3]

Imaging substudies show substantial reduction in visceral adipose tissue and liver fat content

Compare Tirzepatide with Other Compounds